40 Best Texas Wedding Blogs and Websites

Follow Top 40 Texas Wedding Blogs from one place on Feedspot Reader
The best Texas Wedding blogs from thousands of blogs on the web and ranked by relevancy, authority, social media followers & freshness.

Texas Wedding Blogs

Here are 40 Best Texas Wedding Blogs you should follow in 2024

1. Weddings In Houston Blog

Weddings In Houston Blog Houston Wedding Blog is a collection of inspiring ideas, trends, and real Houston weddings to help you plan the perfect day. From breathtaking venues to stunning décor, read these articles to uncover the secrets to planning your perfect day.
weddingsinhouston.com
Twitter Followers 4.2KInstagram Followers 28K Frequency 1 post / week Domain Authority 48 Get Email Contact Get Influential Bloggers ContactsGet access to 250k active Bloggers, Podcasters, YouTubers, and Instagram Influencers in 1500 niche categories.Get targeted media contact list in your niche at your fingertips so you can focus on running your campaign.Email us the type of bloggers you want to reach out for your marketing campaign at anuj@feedspot.com Copy email. We'll share blogger's data in an Excel or CSV format.

2. Hollow Hill Event Center Blog

Hollow Hill Event Center Blog Check out our latest blog post discussing a variety of different wedding aspects. Stay up to date with our latest news and wedding celebrations. Nestled in the midst of the beautiful Texas countryside, Hollow Hill is a full-service event venue offering an ideal setting for an elegant or rustic wedding reception or a country-themed corporate or special event.
hollowhilleventcenter.com
Facebook Followers 4KTwitter Followers 1.2KInstagram Followers 1.5K Frequency 2 posts / month Domain Authority 21 Get Email Contact

3. Wedding Guide Texas Weddings Blog

Wedding Guide Texas Weddings Blog Our mission at Texas Weddings, Ltd. through the Wedding Guide and Bridal Extravaganza, is to provide complete, real-world practical assistance to couples planning their wedding. Throughout the book and the web site, you will find useful information, including ideas to help you create the memorable wedding of your dreams.
texasweddings.com
Facebook Followers 9.1K Frequency 6 posts / month Domain Authority 27 more » Get Email Contact

4. DWeddings.com

DWeddings.com Browse our curated collection of Dallas weddings featuring real weddings with the best local vendors. Whether you seek a romantic garden ceremony, a beautiful ballroom reception, or an elaborate destination wedding, we feature a collection of real weddings to inspire your special day.
dweddings.com
Facebook Followers 8KInstagram Followers 16.7K Frequency 2 posts / month Domain Authority 37 more » Get Email Contact

5. Pink Champagne Designs Blog

Pink Champagne Designs Blog Feel free to browse our blog by scrolling or searching by category. Our blog is here for you to find inspiration for your wedding or event, discover free wedding resources such as wedding tips and tricks, and search for business and visual branding advice. Pink Champagne Designs Blog is a boutique graphic design studio, specializing in weddings and corporate events in Texas.
pinkchampagnedesigns.com
Facebook Followers 1.1KInstagram Followers 15.4K Frequency 3 posts / quarter Domain Authority 21 more » Get Email Contact

6. The Laurel Texas Blog

The Laurel Texas Blog The articles here represent some of our favorite stories, images, and - most importantly - people we have been fortunate enough to celebrate with through the years. We hope you gain inspiration and share the joy we do when we reminisce on these beautiful moments. We are North Texas' newest special events venue perfect for weddings, corporate events, and private gatherings.
thelaureltexas.com
Facebook Followers 3.3KTwitter Followers 74Instagram Followers 5.7K Frequency 2 posts / quarter Domain Authority 23 more » Get Email Contact

7. Bliss Bridal Magazine

Bliss Bridal Magazine Welcome to Bliss Bridal Magazine, a Texas wedding magazine bringing you the latest in wedding trends and inspiration. Bliss Bridal Magazine is a trendy and sophisticated Texas wedding magazine devoted to the style obsessed bride.
blissbridalmagazine.com
Instagram Followers 9.2K Frequency 11 posts / month Domain Authority 17 more » Get Email Contact

8. John David Weddings Blog

John David Weddings Blog However you visualize your wedding, consider me an asset, a guide, and above all, your loyal picture-taker who is here to listen and work with you to support your vision. Wherever you are in your planning process, I want to help you check this box off and rest easy knowing you'll end up with some timeless, fun and editorial-style wedding photography that truly feels like YOU.
johndavidweddings.com
Instagram Followers 6K Frequency 4 posts / year Domain Authority 23 more » Get Email Contact

9. The Oasis Dallas Blog

The Oasis Dallas Blog Check out this top event planning blog covering topics that range from weddings to corporate events, gift guides, decorating ideas, and more! Our expertise is now at your fingertips. The Oasis Dallas is a private Wedding Venue and Event Space in Dallas, Texas.
dallasoasis.com
Instagram Followers 16.5K Frequency 1 post / month Domain Authority 33 more » Get Email Contact

10. Pop Parties Blog

Pop Parties Blog Check out our blog for the latest real weddings, and events by Pop Parties! Fun products, event planning tips, and more resources are just one click away. Pop Parties is a team of highly-trained party planning professionals helping create their clients some of the memorable parties and events for their people.
popparties.com
Facebook Followers 1.6KInstagram Followers 13K Frequency 1 post / quarter Domain Authority 19 more » Get Email Contact

11. Bianca Nichole Blog

Bianca Nichole Blog Bianca Nichole is a Certified Wedding Designer Planner leading team of wedding design professionals to create memorable, lasting experiences for couples in Texas. This blog by her offers top tips, alternatives, new trends, and updates about Planning & Design to readers.
biancanichole.com
Facebook Followers 539Instagram Followers 4.6K Frequency 1 post / quarter Domain Authority 16 more » Get Email Contact

12. Walters Weddings Estate Blog

Walters Weddings Estate Blog Read our blog for expert advice on how to pull off your dream celebration & how we can help step by every blissful step. Walters Wedding Estates is a wedding venue and planning company based in Texas. They exceptional services and resources to make sure their clients have the best experiences on those special days of their life.
waltersweddingestates.com
Facebook Followers 3.3KInstagram Followers 14K Frequency 1 post / month Domain Authority 34 more » Get Email Contact

13. Angela King Photography Blog

Angela King Photography Blog I'm Angela, a wedding photographer for joyful, kind-hearted couples in love. I consider it an incredible honor to capture the most memorable moments of my couples' lives. I see all of the JOY through my lens and reflect it back to you in my images.
angelakingphotography.com
Facebook Followers 1.8K Frequency 7 posts / year Domain Authority 14 more » Get Email Contact

14. Knotting Hill Place's Blog

Knotting Hill Place's Blog Knotting Hill Place's blog is a great resource for couples looking to stay up-to-date on the latest news, trends, and inspiration for their wedding day. The blog covers a wide range of topics, from tips for choosing the perfect wedding dress to ideas for creating unique centerpieces, helping couples stay informed and inspired throughout their wedding planning journey.
knottinghillplace.com
Facebook Followers 8.1KTwitter Followers 10Instagram Followers 18.1K Frequency 4 posts / year Domain Authority 20 more » Get Email Contact

15. Shannon Rose Events Blog

Shannon Rose Events Blog I'm Shannon Rose Ducker. I founded Shannon Rose Events - a full-service wedding planning and design company located in Dallas-Fort Worth that works with couples throughout Texas -almost a decade ago. My approach as a planner and designer is to work closely with my couples to give them the utmost attention and focus on all the details big and small. The blog features our latest weddings and styled designs from our commissions in the Fort Worth, Dallas, & Austin Texas areas.
shannonroseevents.com
Facebook Followers 1.1KInstagram Followers 5.6K Frequency 6 posts / quarter Domain Authority 17 more » Get Email Contact

16. Photography by R.A.Claborn Blog

Photography by R.A.Claborn Blog R.A. Claborn is a Texas wedding photographer located in the DFW area and specializing in Wedding and Portrait sessions. Her blog here showcases her latest project work, behind-the-lens thoughts, photography tips, and more.
byraclaborn.com
Facebook Followers 300Instagram Followers 1.4K Frequency 7 posts / quarter Domain Authority 8 more » Get Email Contact

17. Cliff House Texas Blog

Cliff House Texas Blog Read articles and posts talking about stories, images, and people celebrating some of the finest moments of their life. Cliff House Texas Blog provides a peek into the beautiful approach and results that we create to celebrate people and their moments. Cliff House Texas is one of the biggest and finest venues in the Bishop Arts District of Texas.
cliffhousetexas.com
Facebook Followers 875Instagram Followers 3.9K Frequency 1 post / month Domain Authority 17 more » Get Email Contact

18. Ostreum Blog

Ostreum Blog Explore the beautiful weddings of past clients. Also get easy, smart tips and tricks for your perfect day. Ostreum is a modern, industrial warehouse venue that accommodates a wide range of events. Our high-end amenities give clients the freedom to customize their events. Our original architecture, speakeasy concepts, and updated facilities offer a unique experience.
theostreum.com
Facebook Followers 999Instagram Followers 4.3K Frequency 2 posts / year Domain Authority 16 more » Get Email Contact

19. Rebekah Paul Photography Blog

Rebekah Paul Photography Blog Rebekah Paul, as a wedding photographer cares about documenting the beautiful unscripted moments and the core memories that her clients will be making. Her blog showcases her diverse portfolio of breathtaking moments captured on the most special day of people's lives.
rebekahpaulphotography.com
Instagram Followers 4.5K Frequency 1 post / quarter Domain Authority 10 more » Get Email Contact

20. The Book of Beautiful Weddings Blog

The Book of Beautiful Weddings Blog The Beautiful Weddings Network is a society of the most talented wedding professionals in the Central Texas area. Our mission is to bring you, our readers, wedding content that not only inspires but excites. Our blog is updated with the prettiest inspiration and real weddings, plus all content from The Book of Beautiful Weddings.
thebookofbeautifulweddings.com
Facebook Followers 2KInstagram Followers 6.9K Frequency 11 posts / month Domain Authority 8 more » Get Email Contact

21. Hill Country Bliss Wedding Blog

Hill Country Bliss Wedding Blog Tips, Articles, And Latest News from the Hill Country Bliss Wedding Venue. Stay informed on new features, openings, and news announcements, and enjoy some amazing photo galleries of Hill Country in these articles. Hill Country Bliss Wedding is a leading Wedding and Event Venue in the Texas Hill Country for upscale weddings.
hillcountryblissweddingvenue.com
Facebook Followers 343Instagram Followers 961 Frequency 6 posts / year Domain Authority 17 more » Get Email Contact

22. Ink Weddings Blog

Ink Weddings Blog Catch a glimpse of Exquisite Austin weddings planned by Sydney Myers. She also shares essential tips & tricks for couples to make sure their big day goes perfectly. Her company, Ink Weddings is a Full Sevice Planning Design service based in Austin, Texas.
ininkweddings.com
Facebook Followers 35Instagram Followers 1.2K Frequency 2 posts / month Domain Authority 4 more » Get Email Contact

23. Truly Together Event Co. Blog

Truly Together Event Co. Blog We love connecting with down-to-earth clients who are kind, and compassionate. Our number one goal is to help you enjoy both your wedding and the process it takes to get there. We would love to chat with you to learn about your vision and ideas so we can help bring it all together
trulytogethereventco.com
Frequency 1 post / day Domain Authority 22 more » Get Email Contact

24. Kelley Laws Photography Blog

Kelley Laws Photography Blog Kelley Laws is an award Winning Luxury Wedding Photographer based out of Austin, Texas serving Texas. Kelly captures breathtaking moments of love, laughter, and cherished memories and showcases the beauty of rustic ranches to elegant cityscapes, through her lens. View some of her latest projects in this blog.
kelleylaws.com
Facebook Followers 311Instagram Followers 2.4K Frequency 1 post / month Domain Authority 1 more » Get Email Contact

25. Bride of North Texas

Bride of North Texas Brides of North Texas celebrates DFW weddings and connects brides planning to the best local vendors North Texas has to offer. Brides of North Texas wedding blog is the source to find local wedding ideas and inspiration featuring the best wedding vendors across DFW.
bridesofnorthtexas.com
Facebook Followers 24KTwitter Followers 2.1KInstagram Followers 35.8K Frequency 30 posts / year Domain Authority 47 more » Get Email Contact

26. Austin Wedding Blog

Austin Wedding Blog Austin Wedding is dedicated to inspiring our readers for their big day and helping them make the most informed decisions possible. We want to help simplify that process by offering you only the best advice, from finding your perfect gown to picking a floral designer or caterer. The Austin Wedding Blog is a wedding blog featuring colorful and informative articles, reviews of local vendors, and tips for all things wedding.
austinweddingblog.com
Frequency 10 posts / year Domain Authority 39 more » Get Email Contact

27. 7 Centerpieces Blog

7 Centerpieces Blog Read articles to help you plan your Texas wedding! 7 Centerpieces features the most stunning and unique Texas wedding events, provides features and advice from the state's top vendors, and serves as the go-to resource for couples searching for creative ideas for their Texas nuptials.
7centerpieces.com
Facebook Followers 3.4KTwitter Followers 344Instagram Followers 2.5K Frequency 4 posts / year Domain Authority 39 more » Get Email Contact

28. Texas Wedding Ministers Blog

Texas Wedding Ministers Blog Texas Wedding Ministers is a team of the best professional wedding officiants in Texas. From quick Civil Ceremonies to Virtual Weddings to Customized Wedding Ceremonies, we have a variety of services to meet your needs. Explore in detail about our services and how to get the best experience while planning a special events with tips provided in our blog.
txweddingministers.com
Facebook Followers 3.2KTwitter Followers 221Instagram Followers 420 Frequency 2 posts / year Domain Authority 29 more » Get Email Contact

29. Love Wins Texas

Love Wins Texas Explore our wedding guide blog featuring Texas wedding inspiration, real Texas weddings, the best Southern Texas vendors, and everything to know about getting married in Texas. Love Wins Texas is a licensed and certified wedding consultant company. We have a passion to please and a natural talent for designing and coordinating events.
lovewinstexas.com
Domain Authority 23 Get Email Contact

30. Brides of Austin

Brides of Austin For over 8 years, we've helped those actively planning Austin weddings discover local wedding vendors and plan their dream weddings. We're a team of wedding-obsessed editors who help engaged couples simplify their planning and source the right wedding vendors for their big day!
austin.wedsociety.com
Facebook Followers 19.1K Frequency 30 posts / year Domain Authority 43 more » Get Email Contact

31. Allison Jeffers Photography » Weddings

Allison Jeffers Photography » Weddings Search this blog for some fairy-tale-looking, glam wedding photoshoots I did recently. My name is Allison, and I'm a Texas wedding photographer! I'm basically your behind-the-scenes bridesmaid with a camera who will make sure you look and feel your best! Enjoy creating memories of your best days that last forever.
allisonjeffers.com
Facebook Followers 3K Frequency 1 post / year Domain Authority 39 more » Get Email Contact

32. Holly Marie Photography Blog

Holly Marie Photography Blog We are an Austin, Texas-based wedding photography duo committed to celebrating your Big Day by capturing every joyous, unscripted moment. We care about your stress levels and want to make sure that you are seriously having the time of your life. Go through our blogs to find unique wedding stories and experiences.
hollymarie.photo
Facebook Followers 420Instagram Followers 1.9K Domain Authority 12 more » Get Email Contact

33. Bethany Erin Weddings Blog

Bethany Erin Weddings Blog Explore photo galleries and articles capturing the momentous curation of emotion and memories that are made on the day that two souls choose to be united forever. Bethany Erin is a luxury wedding photographer in Dallas who specializes in providing a second-to-none experience for discerning couples and their families.
bethanyerinweddings.com
Facebook Followers 4.5KInstagram Followers 5.5K Frequency 1 post / year Domain Authority 20 more » Get Email Contact

34. The Courtyard Gaslight Square Blog

The Courtyard Gaslight Square Blog Stay up to date with event ideas and inspiration, trends, local events, and more - sign up to follow our blog! Nestled in the downtown Corpus Christi area, The Courtyard Gaslight Square is a team of professional event planners and event coordinators dedicated to making their clients' special event dreams come true.
thecourtyardatgaslight.com
Facebook Followers 6.5KInstagram Followers 1.3K Domain Authority 16 more » Get Email Contact

35. The Grand Lady Austin Blog

The Grand Lady Austin Blog Read insightful articles about wedding ceremonies in Texas on the official blog page of The Grand Lady in Manor, TX. The Grand Lady Austin is a wedding venue and family-run business, offering the best of services and industry professionals, to provide the perfect backdrop and layout for your day.
grandladyaustin.com
Facebook Followers 1.1KInstagram Followers 5.9K Frequency 4 posts / year Domain Authority 20 more » Get Email Contact

36. Hill Country Weddings Magazines

Hill Country Weddings Magazines Stay up to date with us for more inspiration for your perfect Hill Country wedding! Published two times a year, The Hill Country Weddings & Events Magazine features everything from weddings to events, style, fashion, and more. Plan a wedding that reflects you as a couple and get a wedding planner.
hillcountryweddingsmagazine.com
Facebook Followers 11.7KInstagram Followers 3.4K Domain Authority 19 more » Get Email Contact

37. Jamie Hardin Texas Wedding Blog

Jamie Hardin Texas Wedding Blog Keep up with Texas Wedding Photographers, Jamie Hardin and all of her sessions and weddings she covers from Texas to Mississippi. From the vibrant cityscapes to the serene countryside, Jamie embarks on a journey to capture your most cherished moments and present some of them in his blog here.
jamiehardinphotography.com
Facebook Followers 1.5KInstagram Followers 1.8K Frequency 5 posts / year Domain Authority 10 more » Get Email Contact

38. The Rose Mary Venue Blog

The Rose Mary Venue Blog The RoseMary is an all-white, modern event and wedding venue in Downtown Mckinney. Follow the latest updates for some beautiful wedding photography and sneak-peek into our planning, collaborative approach and flawless services.
therosemaryvenue.com
Facebook Followers 8.5KInstagram Followers 18.3K Domain Authority 1 more » Get Email Contact

Show 38 to 153

Texas Wedding Bloggers

Top Authors, Journalists, and Publishers covering Texas Wedding. Get Spreadsheet
Blogger NameEmailBlog LinkTotal Blog Posts
Corinne/Erinweddingsinhouston.com71
Chloe Philpottaustin.wedsociety.com71
Hayley Sandersthebookofbeautifulweddings.com30
Sarah Jamestexasweddings.com27
Thomas Bainthelaureltexas.com23
kellyrmcgrawpinkchampagnedesigns.com23
Kelleykelleylaws.com23
Dakota Kenwaytexasweddings.com21
byraclabornbyraclaborn.com19
Bianca Trevinobiancanichole.com17
Haley Schermaustin.wedsociety.com17
Ali Chamblessaustin.wedsociety.com15
The Rosemarytherosemaryvenue.com15
Sydney Meyerininkweddings.com14
Kelly McGrawpinkchampagnedesigns.com12
Lynsie Blautheostreum.com11
Miguel Arroyojamiehardinphotography.com10
Bethanybethanyerinweddings.com10
Hill Country Weddingshillcountryweddingsmagazine.com10
Kelsey Moodyaustin.wedsociety.com10
Angela Kingangelakingphotography.com9
Jack Hahndallasoasis.com9
weddinpilovewinstexas.com8
codyshoreshillcountryblissweddingvenue.com8
Veronica Rectortexasweddings.com7
volkanthecourtyardatgaslight.com7
Jillian Shortknottinghillplace.com7
Kristenwaltersweddingestates.com6
Jimmy Willdenthecourtyardatgaslight.com6
The Dallas Oasisdallasoasis.com6
popadminpopparties.com5
Jessica Ottedweddings.com5
jagdeepsinghkalsiblissbridalmagazine.com5
D Weddingsdweddings.com5
waltersweddevwaltersweddingestates.com4
editadminhollowhilleventcenter.com4
Lydia Brooksdweddings.com4
Brian Bannerknottinghillplace.com3
Becky Bannerknottinghillplace.com3
kwestgrandladyaustin.com3
Megan Linnpopparties.com3
Allie Lewisaustin.wedsociety.com3
Walters Adminwaltersweddingestates.com3
Ryan Connerdweddings.com2
Megan Wilhelmbridesofnorthtexas.com2
Pop Partiespopparties.com2
John Davidjohndavidweddings.com2
Melissa Eagantrulytogethereventco.com2
Rebekah Paul Photographyrebekahpaulphotography.com1
Samantha Cuindweddings.com1
Load 51 to 100 of 153 Bloggers